Recombinant Mouse Glucagon receptor (Gcgr), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC21364
Article Name: Recombinant Mouse Glucagon receptor (Gcgr), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC21364
Supplier Catalog Number: RPC21364
Alternative Catalog Number: BIM-RPC21364-20UG,BIM-RPC21364-100UG,BIM-RPC21364-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: GcgrGlucagon receptor, GL-R
Recombinant Mouse Glucagon receptor (Gcgr), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Gcgr. Target Synonyms: GcgrGlucagon receptor, GL-R. Accession Number: Q61606. Expression Region: 27~143aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 40.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 40.8kDa
Tag: N-Terminal Gst-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: AQVMDFLFEKWKLYSDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPPNTTANISCPWYLPWYHKVQHRLVFKRCGPDGQWVRGPRGQPWRNASQCQLDDEEIEVQKGVAKMYSSQQ
Target: Gcgr