Recombinant Human Guanine nucleotide-binding protein G (z) subunit alpha (GNAZ), Unconjugated, E. coli

Catalog Number: BIM-RPC21394
Article Name: Recombinant Human Guanine nucleotide-binding protein G (z) subunit alpha (GNAZ), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC21394
Supplier Catalog Number: RPC21394
Alternative Catalog Number: BIM-RPC21394-20UG,BIM-RPC21394-100UG,BIM-RPC21394-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: G(x) alpha chainGz-alpha
Recombinant Human Guanine nucleotide-binding protein G (z) subunit alpha (GNAZ) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: GNAZ. Target Synonyms: G(x) alpha chainGz-alpha. Accession Number: P19086. Expression Region: 2~355aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 56.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 56.8kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: GCRQSSEEKEAARRSRRIDRHLRSESQRQRREIKLLLLGTSNSGKSTIVKQMKIIHSGGFNLEACKEYKPLIIYNAIDSLTRIIRALAALRIDFHNPDRAYDAVQLFALTGPAESKGEITPELLGVMRRLWADPGAQACFSRSSEYHLEDNAAYYLNDLERIAAADYIPTVEDILRSRDMTTGIVENKFTFKELTFKMVDVGGQRSERKKWIHCFEGVTAIIFCVELSGYDLKLYEDNQTSRMAESLRLFDSICN
Target: GNAZ