Recombinant Mouse Glucose-6-phosphate isomerase (Gpi), Unconjugated, E. coli

Catalog Number: BIM-RPC21404
Article Name: Recombinant Mouse Glucose-6-phosphate isomerase (Gpi), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC21404
Supplier Catalog Number: RPC21404
Alternative Catalog Number: BIM-RPC21404-20UG,BIM-RPC21404-100UG,BIM-RPC21404-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: Autocrine motility factor
Recombinant Mouse Glucose-6-phosphate isomerase (Gpi) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Gpi. Target Synonyms: Autocrine motility factor. Accession Number: P06745. Expression Region: 2~558aa. Tag Info: N-Terminal 6Xhis-B2M-Tagged. Theoretical MW: 76.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 76.6kDa
Tag: N-Terminal 6Xhis-B2M-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: AALTRNPQFQKLLEWHRANSANLKLRELFEADPERFNNFSLNLNTNHGHILVDYSKNLVNKEVMQMLVELAKSRGVEAARDNMFSGSKINYTENRAVLHVALRNRSNTPIKVDGKDVMPEVNRVLDKMKSFCQRVRSGDWKGYTGKSITDIINIGIGGSDLGPLMVTEALKPYSKGGPRVWFVSNIDGTHIAKTLASLSPETSLFIIASKTFTTQETITNAETAKEWFLEAAKDPSAVAKHFVALSTNTAKVKEF
Target: Gpi