Recombinant Rat Glutathione S-transferase P (Gstp1), Unconjugated, E. coli

Catalog Number: BIM-RPC21416
Article Name: Recombinant Rat Glutathione S-transferase P (Gstp1), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC21416
Supplier Catalog Number: RPC21416
Alternative Catalog Number: BIM-RPC21416-20UG,BIM-RPC21416-100UG,BIM-RPC21416-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Rat
Conjugation: Unconjugated
Alternative Names: Chain 7GST 7-7GST class-pi
Recombinant Rat Glutathione S-transferase P (Gstp1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus). Target Name: Gstp1. Target Synonyms: Chain 7GST 7-7GST class-pi. Accession Number: P04906. Expression Region: 2~210aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 27.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 27.3kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: PPYTIVYFPVRGRCEATRMLLADQGQSWKEEVVTIDVWLQGSLKSTCLYGQLPKFEDGDLTLYQSNAILRHLGRSLGLYGKDQKEAALVDMVNDGVEDLRCKYGTLIYTNYENGKDDYVKALPGHLKPFETLLSQNQGGKAFIVGNQISFADYNLLDLLLVHQVLAPGCLDNFPLLSAYVARLSARPKIKAFLSSPDHLNRPINGNGKQ
Target: Gstp1