Recombinant Human Histone H2A.x (H2AFX), Unconjugated, E. coli

Catalog Number: BIM-RPC21429
Article Name: Recombinant Human Histone H2A.x (H2AFX), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC21429
Supplier Catalog Number: RPC21429
Alternative Catalog Number: BIM-RPC21429-20UG,BIM-RPC21429-100UG,BIM-RPC21429-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Histone H2A.X
Recombinant Human Histone H2A.x (H2AFX) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: H2AFX. Target Synonyms: Histone H2A.X. Accession Number: P16104. Expression Region: 1~143aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 42kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 42kDa
Tag: N-Terminal Gst-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY
Target: H2AFX