Recombinant Human Holliday junction recognition protein (HJURP), Unconjugated, E. coli

Catalog Number: BIM-RPC21452
Article Name: Recombinant Human Holliday junction recognition protein (HJURP), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC21452
Supplier Catalog Number: RPC21452
Alternative Catalog Number: BIM-RPC21452-20UG,BIM-RPC21452-100UG,BIM-RPC21452-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: 14-3-3-associated AKT substrateFetal liver-expressing gene 1 proteinUp-regulated in lung cancer 9
Recombinant Human Holliday junction recognition protein (HJURP) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: HJURP. Target Synonyms: 14-3-3-associated AKT substrateFetal liver-expressing gene 1 proteinUp-regulated in lung cancer 9. Accession Number: Q8NCD3. Expression Region: 1~748aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 99.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 99.5kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MLGTLRAMEGEDVEDDQLLQKLRASRRRFQRRMQRLIEKYNQPFEDTPVVQMATLTYETPQGLRIWGGRLIKERNEGEIQDSSMKPADRTDGSVQAAAWGPELPSHRTVLGADSKSGEVDATSDQEESVAWALAPAVPQSPLKNELRRKYLTQVDILLQGAEYFECAGNRAGRDVRVTPLPSLASPAVPAPGYCSRISRKSPGDPAKPASSPREWDPLHPSSTDMALVPRNDSLSLQETSSSSFLSSQPFEDDDI
Target: HJURP