Recombinant Human Heme oxygenase 1 (HMOX1), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC21462
Article Name: Recombinant Human Heme oxygenase 1 (HMOX1), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC21462
Supplier Catalog Number: RPC21462
Alternative Catalog Number: BIM-RPC21462-20UG,BIM-RPC21462-100UG,BIM-RPC21462-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: 32 kD, bK286B10, D8Wsu38e, heat shock protein 32 kD, heat shock protein 32kD, Heat shock protein, Heme oxygenase (decycling) 1, Heme oxygenase 1, Hemox, HMOX 1, Hmox, Hmox1, HMOX1_HUMAN, HO 1, HO, HO-1, HO1, Hsp32
Recombinant Human Heme oxygenase 1 (HMOX1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: HMOX1. Target Synonyms: 32 kD, bK286B10, D8Wsu38e, heat shock protein 32 kD, heat shock protein 32kD, Heat shock protein, Heme oxygenase (decycling) 1, Heme oxygenase 1, Hemox, HMOX 1, Hmox, Hmox1, HMOX1_HUMAN, HO 1, HO, HO-1, HO1, Hsp32. Accession Number: P09601. Expression Region: 3~288aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 36.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 36.6kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: RPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKP
Target: HMOX1