Recombinant Human Alpha-L-iduronidase (IDUA), Unconjugated, E. coli

Catalog Number: BIM-RPC21487
Article Name: Recombinant Human Alpha-L-iduronidase (IDUA), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC21487
Supplier Catalog Number: RPC21487
Alternative Catalog Number: BIM-RPC21487-20UG,BIM-RPC21487-100UG,BIM-RPC21487-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: IDUA, Alpha-L-iduronidase, EC 3.2.1.76
Recombinant Human Alpha-L-iduronidase (IDUA) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: IDUA. Target Synonyms: IDUA, Alpha-L-iduronidase, EC 3.2.1.76. Accession Number: P35475. Expression Region: 28~653aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 73.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 73.9kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: APHLVHVDAARALWPLRRFWRSTGFCPPLPHSQADQYVLSWDQQLNLAYVGAVPHRGIKQVRTHWLLELVTTRGSTGRGLSYNFTHLDGYLDLLRENQLLPGFELMGSASGHFTDFEDKQQVFEWKDLVSSLARRYIGRYGLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRHCHDGTNFFTGEAGVRLDYISLHRKGARSSISILEQEKVVAQQ
Target: IDUA