Recombinant Macaca mulatta (Rhesus macaque) Interleukin-1 alpha (IL1A), Unconjugated, E. coli

Catalog Number: BIM-RPC21509
Article Name: Recombinant Macaca mulatta (Rhesus macaque) Interleukin-1 alpha (IL1A), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC21509
Supplier Catalog Number: RPC21509
Alternative Catalog Number: BIM-RPC21509-20UG,BIM-RPC21509-100UG,BIM-RPC21509-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Monkey
Conjugation: Unconjugated
Alternative Names: Hematopoietin-1
Recombinant Macaca mulatta (Rhesus macaque) Interleukin-1 alpha (IL1A) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Macaca mulatta (Rhesus macaque). Target Name: IL1A. Target Synonyms: Hematopoietin-1. Accession Number: P48089. Expression Region: 113~271aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 34.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 34.1kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: SAPFSFLSNMTYHFIRIIKHEFILNDTLNQTIIRANDQHLTAAAIHNLDEAVKFDMGAYTSSKDDTKVPVILRISKTQLYVSAQDEDQPVLLKEMPEINKTITGSETNFLFFWETHGTKNYFISVAHPNLFIATKHDNWVCLAKGLPSITDFQILENQA
Target: IL1A