Recombinant Sheep Interleukin-1 beta (IL1B), Unconjugated, E. coli

Catalog Number: BIM-RPC21512
Article Name: Recombinant Sheep Interleukin-1 beta (IL1B), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC21512
Supplier Catalog Number: RPC21512
Alternative Catalog Number: BIM-RPC21512-20UG,BIM-RPC21512-100UG,BIM-RPC21512-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Sheep
Conjugation: Unconjugated
Alternative Names: IL1BInterleukin-1 beta, IL-1 beta
Recombinant Sheep Interleukin-1 beta (IL1B) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Sheep (Ovis aries). Target Name: IL1B. Target Synonyms: IL1BInterleukin-1 beta, IL-1 beta. Accession Number: P21621. Expression Region: 114~266aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 21.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 21.7kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: AAVQSVKCKLQDREQKSLVLDSPCVLKALHLPSQEMSREVVFCMSFVQGEERDNKIPVALGIRDKNLYLSCVKKGDTPTLQLEEVDPKVYPKRNMEKRFVFYKTEIKNTVEFESVLYPNWYISTSQIEEKPVFLGRFRGGQDITDFRMETLSP
Target: IL1B