Recombinant Mouse Interleukin-2 receptor subunit beta (Il2rb), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC21516
Article Name: Recombinant Mouse Interleukin-2 receptor subunit beta (Il2rb), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC21516
Supplier Catalog Number: RPC21516
Alternative Catalog Number: BIM-RPC21516-20UG,BIM-RPC21516-100UG,BIM-RPC21516-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: High affinity IL-2 receptor subunit betap70-75, CD122
Recombinant Mouse Interleukin-2 receptor subunit beta (Il2rb), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: l2rb. Target Synonyms: High affinity IL-2 receptor subunit betap70-75, CD122. Accession Number: P16297. Expression Region: 24~240aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 29.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 29.3kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: ASAAVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPADPMKE
Target: l2rb