Recombinant Mouse Tyrosine-protein kinase JAK1 (Jak1), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC21544
Article Name: Recombinant Mouse Tyrosine-protein kinase JAK1 (Jak1), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC21544
Supplier Catalog Number: RPC21544
Alternative Catalog Number: BIM-RPC21544-20UG,BIM-RPC21544-100UG,BIM-RPC21544-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: Janus kinase 1JAK-1
Recombinant Mouse Tyrosine-protein kinase JAK1 (Jak1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Jak1. Target Synonyms: Janus kinase 1JAK-1. Accession Number: P52332. Expression Region: 848~1152aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 39.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 39.1kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: EEQNPDIVSEKQPTTEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICMEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAIQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLIQCKFYIASDVWSFGVTLHELLTYCDSDFSPMALFLKMIGPTHGQMTVTR
Target: Jak1