Recombinant Human KeRatin, type I cytoskeletal 18 (KRT18), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC21578
Article Name: Recombinant Human KeRatin, type I cytoskeletal 18 (KRT18), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC21578
Supplier Catalog Number: RPC21578
Alternative Catalog Number: BIM-RPC21578-20UG,BIM-RPC21578-100UG,BIM-RPC21578-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Cell proliferation-inducing gene 46 protein, Cytokeratin-18, CK-18Keratin-18, K18
Recombinant Human KeRatin, type I cytoskeletal 18 (KRT18), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: KRT18. Target Synonyms: Cell proliferation-inducing gene 46 protein, Cytokeratin-18, CK-18Keratin-18, K18. Accession Number: P05783. Expression Region: 11~430aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 50.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 50.9kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: TNYRSLGSVQAPSYGARPVSSAASVYAGAGGSGSRISVSRSTSFRGGMGSGGLATGIAGGLAGMGGIQNEKETMQSLNDRLASYLDRVRSLETENRRLESKIREHLEKKGPQVRDWSHYFKIIEDLRAQIFANTVDNARIVLQIDNARLAADDFRVKYETELAMRQSVENDIHGLRKVIDDTNITRLQLETEIEALKEELLFMKKNHEEEVKGLQAQIASSGLTVEVDAPKSQDLAKIMADIRAQYDELARKNRE
Target: KRT18