Recombinant Human Laminin subunit alpha-5 (LAMA5), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC21586
Article Name: Recombinant Human Laminin subunit alpha-5 (LAMA5), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC21586
Supplier Catalog Number: RPC21586
Alternative Catalog Number: BIM-RPC21586-20UG,BIM-RPC21586-100UG,BIM-RPC21586-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Laminin-10 subunit alphaLaminin-11 subunit alphaLaminin-15 subunit alpha
Recombinant Human Laminin subunit alpha-5 (LAMA5), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: LAMA5. Target Synonyms: Laminin-10 subunit alphaLaminin-11 subunit alphaLaminin-15 subunit alpha. Accession Number: O15230. Expression Region: 3401~3692aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 47.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 47.1kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: FVAQMEGLGTRLRAQSRQRSRPGRWHKVSVRWEKNRILLVTDGARAWSQEGPHRQHQGAEHPQPHTLFVGGLPASSHSSKLPVTVGFSGCVKRLRLHGRPLGAPTRMAGVTPCILGPLEAGLFFPGSGGVITLDLPGATLPDVGLELEVRPLAVTGLIFHLGQARTPPYLQLQVTEKQVLLRADDGAGEFSTSVTRPSVLCDGQWHRLAVMKSGNVLRLEVDAQSNHTVGPLLAAAAGAPAPLYLGGLPEPMAVQ
Target: LAMA5