Recombinant Bovine Lutropin subunit beta (LHB), Unconjugated, E. coli

Catalog Number: BIM-RPC21604
Article Name: Recombinant Bovine Lutropin subunit beta (LHB), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC21604
Supplier Catalog Number: RPC21604
Alternative Catalog Number: BIM-RPC21604-20UG,BIM-RPC21604-100UG,BIM-RPC21604-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bovine
Conjugation: Unconjugated
Alternative Names: Luteinizing hormone subunit beta, LH-B, LSH-B, LSH-beta, Lutropin beta chain
Recombinant Bovine Lutropin subunit beta (LHB) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bovine (Bos taurus). Target Name: LHB. Target Synonyms: Luteinizing hormone subunit beta, LH-B, LSH-B, LSH-beta, Lutropin beta chain. Accession Number: P04651. Expression Region: 21~141aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 17kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 17kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: SRGPLRPLCQPINATLAAEKEACPVCITFTTSICAGYCPSMKRVLPVILPPMPQRVCTYHELRFASVRLPGCPPGVDPMVSFPVALSCHCGPCRLSSTDCGGPRTQPLACDHPPLPDILFL
Target: LHB