Recombinant Human Stromelysin-1 (MMP3), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC21674
Article Name: Recombinant Human Stromelysin-1 (MMP3), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC21674
Supplier Catalog Number: RPC21674
Alternative Catalog Number: BIM-RPC21674-20UG,BIM-RPC21674-100UG,BIM-RPC21674-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Matrix metalloproteinase-3, MMP-3Transin-1
Recombinant Human Stromelysin-1 (MMP3), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: MMP3. Target Synonyms: Matrix metalloproteinase-3, MMP-3Transin-1. Accession Number: P08254. Expression Region: 102~477aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 58.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 58.5kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: TFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVSTLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFK
Target: MMP3