Recombinant Human Myelin protein P0 (MPZ), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC21682
Article Name: Recombinant Human Myelin protein P0 (MPZ), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC21682
Supplier Catalog Number: RPC21682
Alternative Catalog Number: BIM-RPC21682-20UG,BIM-RPC21682-100UG,BIM-RPC21682-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Myelin peripheral protein, MPPMyelin protein zero
Recombinant Human Myelin protein P0 (MPZ), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: MPZ. Target Synonyms: Myelin peripheral protein, MPPMyelin protein zero. Accession Number: P25189. Expression Region: 30~156aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 18.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 18.5kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: IVVYTDREVHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGV
Target: MPZ