Recombinant Human Methylmalonyl-CoA mutase, mitochondrial (MMUT), Unconjugated, E. coli

Catalog Number: BIM-RPC21704
Article Name: Recombinant Human Methylmalonyl-CoA mutase, mitochondrial (MMUT), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC21704
Supplier Catalog Number: RPC21704
Alternative Catalog Number: BIM-RPC21704-20UG,BIM-RPC21704-100UG,BIM-RPC21704-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Methylmalonyl-CoA isomerase
Recombinant Human Methylmalonyl-CoA mutase, mitochondrial (MMUT) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: MMUT. Target Synonyms: Methylmalonyl-CoA isomerase. Accession Number: P22033. Expression Region: 33~750aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 84.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 84.8kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: LHQQQPLHPEWAALAKKQLKGKNPEDLIWHTPEGISIKPLYSKRDTMDLPEELPGVKPFTRGPYPTMYTFRPWTIRQYAGFSTVEESNKFYKDNIKAGQQGLSVAFDLATHRGYDSDNPRVRGDVGMAGVAIDTVEDTKILFDGIPLEKMSVSMTMNGAVIPVLANFIVTGEEQGVPKEKLTGTIQNDILKEFMVRNTYIFPPEPSMKIIADIFEYTAKHMPKFNSISISGYHMQEAGADAILELAYTLADGLEY
Target: MMUT