Recombinant Salmonella typhimurium Outer membrane porin protein OmpD (ompD), Unconjugated, E. coli

Catalog Number: BIM-RPC22557
Article Name: Recombinant Salmonella typhimurium Outer membrane porin protein OmpD (ompD), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22557
Supplier Catalog Number: RPC22557
Alternative Catalog Number: BIM-RPC22557-20UG,BIM-RPC22557-100UG,BIM-RPC22557-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: ompD, nmpC, STM1572, Outer membrane porin protein OmpD
Recombinant Salmonella typhimurium Outer membrane porin protein OmpD (ompD) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720). Target Name: ompD. Target Synonyms: ompD, nmpC, STM1572, Outer membrane porin protein OmpD. Accession Number: P37592. Expression Region: 22~362aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 53.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 53.6kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: AEVYNKDGNKLDLYGKVHAQHYFSDDNGSDGDKTYARLGFKGETQINDQLTGFGQWEYEFKGNRTESQGADKDKTRLAFAGLKFADYGSFDYGRNYGVAYDIGAWTDVLPEFGGDTWTQTDVFMTGRTTGVATYRNTDFFGLVEGLNFAAQYQGKNDRDGAYESNGDGFGLSATYEYEGFGVGAAYAKSDRTNNQVKAASNLNAAGKNAEVWAAGLKYDANNIYLATTYSETLNMTTFGEDAAGDAFIANKTQNF
Target: ompD