Recombinant Saccharomyces cerevisiae Polyphosphatase (PPX1), Unconjugated, E. coli

Catalog Number: BIM-RPC22558
Article Name: Recombinant Saccharomyces cerevisiae Polyphosphatase (PPX1), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22558
Supplier Catalog Number: RPC22558
Alternative Catalog Number: BIM-RPC22558-20UG,BIM-RPC22558-100UG,BIM-RPC22558-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Yeast
Conjugation: Unconjugated
Alternative Names: Metaphosphatase
Recombinant Saccharomyces cerevisiae Polyphosphatase (PPX1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast). Target Name: PPX1. Target Synonyms: Metaphosphatase. Accession Number: P38698. Expression Region: 1~397aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 49.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 49.1kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MSPLRKTVPEFLAHLKSLPISKIASNDVLTICVGNESADMDSIASAITYSYCQYIYNEGTYSEEKKKGSFIVPIIDIPREDLSLRRDVMYVLEKLKIKEEELFFIEDLKSLKQNVSQGTELNSYLVDNNDTPKNLKNYIDNVVGIIDHHFDLQKHLDAEPRIVKVSGSCSSLVFNYWYEKLQGDREVVMNIAPLLMGAILIDTSNMRRKVEESDKLAIERCQAVLSGAVNEVSAQGLEDSSEFYKEIKSRKNDIK
Target: PPX1