Recombinant Sulfolobus solfataricus DNA-binding protein 7d (sso7d), Unconjugated, E. coli

Catalog Number: BIM-RPC22560
Article Name: Recombinant Sulfolobus solfataricus DNA-binding protein 7d (sso7d), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22560
Supplier Catalog Number: RPC22560
Alternative Catalog Number: BIM-RPC22560-20UG,BIM-RPC22560-100UG,BIM-RPC22560-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: 7 kDa DNA-binding protein dSso7d
Recombinant Sulfolobus solfataricus DNA-binding protein 7d (sso7d) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2). Target Name: sso7d. Target Synonyms: 7 kDa DNA-binding protein dSso7d. Accession Number: P39476. Expression Region: 2~64aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 23.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 23.1kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: ATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKK
Target: sso7d