Recombinant Saccharum officinarum Sucrose synthase (SUS1), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC22568
Article Name: Recombinant Saccharum officinarum Sucrose synthase (SUS1), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22568
Supplier Catalog Number: RPC22568
Alternative Catalog Number: BIM-RPC22568-20UG,BIM-RPC22568-100UG,BIM-RPC22568-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Plant
Conjugation: Unconjugated
Alternative Names: Sucrose-UDP glucosyltransferase
Recombinant Saccharum officinarum Sucrose synthase (SUS1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Saccharum officinarum (Sugarcane). Target Name: SUS1. Target Synonyms: Sucrose-UDP glucosyltransferase. Accession Number: P31925. Expression Region: 1~218aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 41.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 41.3kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: ARLDRVKNMTGPVEISGKKARLRELANPVIVAGDHGKESKDRDEAEEQGGFKKMYSLIDDYKFKGHIRLISAQMNRVRNGELYQYICDTKGAFVQPAYEAFRLDCDRVHEVRSAKDRDLPWRPCEIIADGVSGLHIDPYHSDKDADILVNFFDKCNADPSYWDEISQGGQRIYEKYTWKLYSERLMTLTGAYGFWNYVSKLERGDTRYIDMFYALEYP
Target: SUS1