Recombinant Newcastle disease virus Hemagglutinin-neuraminidase (HN), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC22571
Article Name: Recombinant Newcastle disease virus Hemagglutinin-neuraminidase (HN), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22571
Supplier Catalog Number: RPC22571
Alternative Catalog Number: BIM-RPC22571-20UG,BIM-RPC22571-100UG,BIM-RPC22571-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Virus
Conjugation: Unconjugated
Alternative Names: HN, Hemagglutinin-neuraminidase, EC 3.2.1.18
Recombinant Newcastle disease virus Hemagglutinin-neuraminidase (HN), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Newcastle disease virus (strain Her/33) (NDV). Target Name: HN. Target Synonyms: HN, Hemagglutinin-neuraminidase, EC 3.2.1.18. Accession Number: P35741. Expression Region: 115~473aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 44.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 44.2kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: NGAANNSGCGAPVHDPDYIGGIGKELIVDDASDVTSFYPSAFQEHLNFIPAPTTGSGCTRIPSFDISATHYCYTHNVILSGCRDHSHSHQYLALGVLRTSATGRVFFSTLRSINLDDNQNRKSCSVSATPLGCDMLCSKITETEEEDYSSVTPTSMVHGRLGFDGQYHEKDLDVITLFKDWVANYPGVGGGSFIDNRVWFPVYGGLKPNSPSDTVQEGRYVIYKRYNDTCPDEQDYQIRMAKSSYKPGRFGGKRV
Target: HN