Recombinant Mouse Carboxylesterase 1C (Ces1c), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC22583
Article Name: Recombinant Mouse Carboxylesterase 1C (Ces1c), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22583
Supplier Catalog Number: RPC22583
Alternative Catalog Number: BIM-RPC22583-20UG,BIM-RPC22583-100UG,BIM-RPC22583-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: Liver carboxylesterase NLung surfactant convertasePES-N
Recombinant Mouse Carboxylesterase 1C (Ces1c), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Ces1c. Target Synonyms: Liver carboxylesterase NLung surfactant convertasePES-N. Accession Number: P23953. Expression Region: 19~550aa. Tag Info: Tag-Free. Theoretical MW: 58.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 58.6kDa
Tag: Tag-Free
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: HSLLPPVVDTTQGKVLGKYISLEGFEQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNATSYPPMCSQDAGWAKILSDMFSTEKEILPLKISEDCLYLNIYSPADLTKSSQLPVMVWIHGGGLVIGGASPYNGLALSAHENVVVVTIQYRLGIWGLFSTGDEHSPGNWAHLDQLAALRWVQDNIANFGGNPDSVTIFGESSGGISVSVLVLSPLGKDLFHRAISESGVVINTNVGKKNIQAVNEIIATLSQC
Target: Ces1c