Recombinant Yersinia pestis F1 capsule antigen (caf1), Unconjugated, E. coli

Catalog Number: BIM-RPC22584
Article Name: Recombinant Yersinia pestis F1 capsule antigen (caf1), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22584
Supplier Catalog Number: RPC22584
Alternative Catalog Number: BIM-RPC22584-20UG,BIM-RPC22584-100UG,BIM-RPC22584-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: caf1, YPMT1.84, Y1100, YP_pMT082F1 capsule antigen
Recombinant Yersinia pestis F1 capsule antigen (caf1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Yersinia pestis. Target Name: caf1. Target Synonyms: caf1, YPMT1.84, Y1100, YP_pMT082F1 capsule antigen. Accession Number: P26948. Expression Region: 22~170aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 19.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 19.6kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: ADLTASTTATATLVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ
Target: caf1