Recombinant Human Melanoma-associated antigen 1 (MAGEA1), Unconjugated, Yeast

Catalog Number: BIM-RPC24802
Article Name: Recombinant Human Melanoma-associated antigen 1 (MAGEA1), Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC24802
Supplier Catalog Number: RPC24802
Alternative Catalog Number: BIM-RPC24802-20UG,BIM-RPC24802-100UG,BIM-RPC24802-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Antigen MZ2-ECancer/testis antigen 1.1, CT1.1MAGE-1 antigen
Recombinant Human Melanoma-associated antigen 1 (MAGEA1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: MAGEA1. Target Synonyms: Antigen MZ2-ECancer/testis antigen 1.1, CT1.1MAGE-1 antigen. Accession Number: P43355. Expression Region: 1~309aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 36.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 36.3kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MSLEQRSLHCKPEEALEAQQEALGLVCVQAATSSSSPLVLGTLEEVPTAGSTDPPQSPQGASAFPTTINFTRQRQPSEGSSSREEEGPSTSCILESLFRAVITKKVADLVGFLLLKYRAREPVTKAEMLESVIKNYKHCFPEIFGKASESLQLVFGIDVKEADPTGHSYVLVTCLGLSYDGLLGDNQIMPKTGFLIIVLVMIAMEGGHAPEEEIWEELSVMEVYDGREHSAYGEPRKLLTQDLVQEKYLEYRQVP
Target: MAGEA1