Recombinant Human Peroxiredoxin-1 (PRDX1), Unconjugated, Yeast

Catalog Number: BIM-RPC24890
Article Name: Recombinant Human Peroxiredoxin-1 (PRDX1), Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC24890
Supplier Catalog Number: RPC24890
Alternative Catalog Number: BIM-RPC24890-20UG,BIM-RPC24890-100UG,BIM-RPC24890-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Natural killer cell-enhancing factor AProliferation-associated gene proteinThioredoxin peroxidase 2Thioredoxin-dependent peroxide reductase 2PAGA, PAGB, TDPX2
Recombinant Human Peroxiredoxin-1 (PRDX1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: PRDX1. Target Synonyms: Natural killer cell-enhancing factor AProliferation-associated gene proteinThioredoxin peroxidase 2Thioredoxin-dependent peroxide reductase 2PAGA, PAGB, TDPX2. Accession Number: Q06830. Expression Region: 1~199aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 24.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 24.6kDa
Tag: N-Terminal 10Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK
Target: PRDX1