Recombinant Human Inactive tyrosine-protein kinase transmembrane receptor ROR1 (ROR1), partial, Unconjugated, Yeast

Catalog Number: BIM-RPC24926
Article Name: Recombinant Human Inactive tyrosine-protein kinase transmembrane receptor ROR1 (ROR1), partial, Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC24926
Supplier Catalog Number: RPC24926
Alternative Catalog Number: BIM-RPC24926-20UG,BIM-RPC24926-100UG,BIM-RPC24926-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Neurotrophic tyrosine kinase, receptor-related 1
Recombinant Human Inactive tyrosine-protein kinase transmembrane receptor ROR1 (ROR1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: ROR1. Target Synonyms: Neurotrophic tyrosine kinase, receptor-related 1. Accession Number: Q01973. Expression Region: 30~391aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 42.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 42.6kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCED
Target: ROR1