Recombinant E. coli Periplasmic serine endoprotease DegP (degP), Unconjugated, Yeast

Catalog Number: BIM-RPC25077
Article Name: Recombinant E. coli Periplasmic serine endoprotease DegP (degP), Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC25077
Supplier Catalog Number: RPC25077
Alternative Catalog Number: BIM-RPC25077-20UG,BIM-RPC25077-100UG,BIM-RPC25077-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: E. coli
Conjugation: Unconjugated
Alternative Names: Heat shock protein DegPProtease Do
Recombinant E. coli Periplasmic serine endoprotease DegP (degP) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: E. coli (strain K12). Target Name: degP. Target Synonyms: Heat shock protein DegPProtease Do. Accession Number: P0C0V0. Expression Region: 27~474aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 48.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 48.8kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: AETSSATTAQQMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGGNGGGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNSGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMV
Target: degP