Recombinant Epstein-Barr virus Latent membrane protein 1 (LMP1), partial, Unconjugated, Yeast

Catalog Number: BIM-RPC25086
Article Name: Recombinant Epstein-Barr virus Latent membrane protein 1 (LMP1), partial, Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC25086
Supplier Catalog Number: RPC25086
Alternative Catalog Number: BIM-RPC25086-20UG,BIM-RPC25086-100UG,BIM-RPC25086-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Virus
Conjugation: Unconjugated
Alternative Names: Protein p63
Recombinant Epstein-Barr virus Latent membrane protein 1 (LMP1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Epstein-Barr virus (strain Raji) (HHV-4) (Human herpesvirus 4). Target Name: LMP1. Target Synonyms: Protein p63. Accession Number: P13198. Expression Region: 185~386aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 23kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 23kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: YYHGQRHSDEHHHDDSLPHPQQATDDSSNQSDSNSNEGRHLLLVSGAGDGPPLCSQNLGAPGGGPNNGPQDPDNTDDNGPQDPDNTDDNGPHDPLPQDPDNTDDNGPQDPDNTDDNGPHDPLPHNPSDSAGNDGGPPQLTEEVENKGGDQGPPLMTDGGGGHSHDSGHDGIDPHLPTLLLGTSGSGGDDDDPHGPVQLSYYD
Target: LMP1