Recombinant Rat Trypsin-4 (Try4), Unconjugated, Yeast

Catalog Number: BIM-RPC25092
Article Name: Recombinant Rat Trypsin-4 (Try4), Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC25092
Supplier Catalog Number: RPC25092
Alternative Catalog Number: BIM-RPC25092-20UG,BIM-RPC25092-100UG,BIM-RPC25092-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Rat
Conjugation: Unconjugated
Alternative Names: Pretrypsinogen IVTrypsin IV
Recombinant Rat Trypsin-4 (Try4) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus). Target Name: Try4. Target Synonyms: Pretrypsinogen IVTrypsin IV. Accession Number: P12788. Expression Region: 24~247aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 26.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 26.1kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: IVGGYTCPKHLVPYQVSLHDGISHQCGGSLISDQWVLSAAHCYKRKLQVRLGEHNIHVLEGGEQFIDAEKIIRHPEYNKDTLDNDIMLIKLKSPAVLNSQVSTVSLPRSCASTDAQCLVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKKSYPGQITSNMFCLGFLEGGKDSCDGDSGGPVVCNGEIQGIVSWGSVCAMRGKPGVYTKVCNYLSWIQETMANN
Target: Try4