Recombinant Helicobacter pylori Urease subunit alpha (ureA), Unconjugated, Yeast

Catalog Number: BIM-RPC25100
Article Name: Recombinant Helicobacter pylori Urease subunit alpha (ureA), Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC25100
Supplier Catalog Number: RPC25100
Alternative Catalog Number: BIM-RPC25100-20UG,BIM-RPC25100-100UG,BIM-RPC25100-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: H. pylori
Conjugation: Unconjugated
Alternative Names: Urea amidohydrolase subunit alpha
Recombinant Helicobacter pylori Urease subunit alpha (ureA) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori). Target Name: ureA. Target Synonyms: Urea amidohydrolase subunit alpha. Accession Number: P14916. Expression Region: 1~238aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 28.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 28.5kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MKLTPKELDKLMLHYAGELAKKRKEKGIKLNYVEAVALISAHIMEEARAGKKTAAELMQEGRTLLKPDDVMDGVASMIHEVGIEAMFPDGTKLVTVHTPIEANGKLVPGELFLKNEDITINEGKKAVSVKVKNVGDRPVQIGSHFHFFEVNRCLDFDREKTFGKRLDIASGTAVRFEPGEEKSVELIDIGGNRRIFGFNALVDRQADNESKKIALHRAKERGFHGAKSDDNYVKTIKE
Target: ureA