Recombinant Malus domestica Major allergen Mal d 1 (MALD1), Unconjugated, Yeast

Catalog Number: BIM-RPC25148
Article Name: Recombinant Malus domestica Major allergen Mal d 1 (MALD1), Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC25148
Supplier Catalog Number: RPC25148
Alternative Catalog Number: BIM-RPC25148-20UG,BIM-RPC25148-100UG,BIM-RPC25148-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Plant
Conjugation: Unconjugated
Alternative Names: Allergen Mal d IAllergen: Mal d 1
Recombinant Malus domestica Major allergen Mal d 1 (MALD1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Malus domestica (Apple) (Pyrus malus). Target Name: MALD1. Target Synonyms: Allergen Mal d IAllergen: Mal d 1. Accession Number: P43211. Expression Region: 2~159aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 19.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 19.5kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHYHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN
Target: MALD1