Recombinant Human herpesvirus 6A DNA polymerase processivity factor (U27), Unconjugated, Yeast

Catalog Number: BIM-RPC25200
Article Name: Recombinant Human herpesvirus 6A DNA polymerase processivity factor (U27), Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC25200
Supplier Catalog Number: RPC25200
Alternative Catalog Number: BIM-RPC25200-20UG,BIM-RPC25200-100UG,BIM-RPC25200-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Virus
Conjugation: Unconjugated
Alternative Names: Phosphoprotein P41, PP41, Polymerase accessory protein, PAP
Recombinant Human herpesvirus 6A DNA polymerase processivity factor (U27) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human herpesvirus 6A (strain Uganda-1102) (HHV-6 variant A) (Human B lymphotropic virus). Target Name: U27. Target Synonyms: Phosphoprotein P41, PP41, Polymerase accessory protein, PAP. Accession Number: P52439. Expression Region: 1~393aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 46.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 46.8kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MCWSFHLFFKAHKARVGARTSFLTEMERGSRDHHRDHRDHREHRETREPPTLAFHMKSWKTINKSLKAFAKLLKENTTVTFTPQPSIIIQSAKNHLVQKLTIQAECLFLSDTDRFLTKTINNHIPLFESFMNIISNPEVTKMYIQHDSDLYTRVLVTASDTCTQASVPCVHGQEVVRDTGRSPLRIDLDHSTVSDVLKWLSPVTKTKRSGKSDALMAHIIVQVNPPTIKFVTEMNELEFSNSNKVIFYDVKNMRF
Target: U27