Recombinant Centruroides noxius Beta-mammal toxin Cn2, Unconjugated, Yeast

Catalog Number: BIM-RPC25213
Article Name: Recombinant Centruroides noxius Beta-mammal toxin Cn2, Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC25213
Supplier Catalog Number: RPC25213
Alternative Catalog Number: BIM-RPC25213-20UG,BIM-RPC25213-100UG,BIM-RPC25213-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Conjugation: Unconjugated
Alternative Names: Toxin II.9.2.2
Recombinant Centruroides noxius Beta-mammal toxin Cn2 is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Centruroides noxius (Mexican scorpion). Target Name: Centruroides noxius Beta-mammal toxin Cn2. Target Synonyms: Toxin II.9.2.2. Accession Number: P01495. Expression Region: 17~82aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 9.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 9.6kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: KEGYLVDKNTGCKYECLKLGDNDYCLRECKQQYGKGAGGYCYAFACWCTHLYEQAIVWPLPNKRCS
Target: Centruroides noxius Beta-mammal toxin Cn2