Recombinant Anemonia sulcata Delta-actitoxin-Avd1c, Unconjugated, Yeast

Catalog Number: BIM-RPC25214
Article Name: Recombinant Anemonia sulcata Delta-actitoxin-Avd1c, Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC25214
Supplier Catalog Number: RPC25214
Alternative Catalog Number: BIM-RPC25214-20UG,BIM-RPC25214-100UG,BIM-RPC25214-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Conjugation: Unconjugated
Alternative Names: ATX-II
Recombinant Anemonia sulcata Delta-actitoxin-Avd1c is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Anemonia sulcata (Mediterranean snakelocks sea anemone). Target Name: Anemonia sulcata Delta-actitoxin-Avd1c. Target Synonyms: ATX-II. Accession Number: P01528. Expression Region: 1~47aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 6.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 6.9kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: GVPCLCDSDGPSVRGNTLSGIIWLAGCPSGWHNCKKHGPTIGWCCKQ
Target: Anemonia sulcata Delta-actitoxin-Avd1c