Recombinant Mouse Gastric inhibitory polypeptide receptor (Gipr), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC27509
Article Name: Recombinant Mouse Gastric inhibitory polypeptide receptor (Gipr), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27509
Supplier Catalog Number: RPC27509
Alternative Catalog Number: BIM-RPC27509-20UG,BIM-RPC27509-100UG,BIM-RPC27509-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: Glucose-dependent insulinotropic polypeptide receptor
Recombinant Mouse Gastric inhibitory polypeptide receptor (Gipr), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Gipr. Target Synonyms: Glucose-dependent insulinotropic polypeptide receptor. Accession Number: Q0P543. Expression Region: 19~134aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 20.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 20.8kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: ETDSEGQTTTGELYQRWEHYGQECQKMLETTEPPSGLACNGSFDMYACWNYTAANTTARVSCPWYLPWFRQVSAGFVFRQCGSDGQWGSWRDHTQCENPEKNGAFQDQTLILERLQ
Target: Gipr