Recombinant Mouse High mobility group protein B1 (Hmgb1), Unconjugated, E. coli

Catalog Number: BIM-RPC27515
Article Name: Recombinant Mouse High mobility group protein B1 (Hmgb1), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27515
Supplier Catalog Number: RPC27515
Alternative Catalog Number: BIM-RPC27515-20UG,BIM-RPC27515-100UG,BIM-RPC27515-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: High mobility group protein 1
Recombinant Mouse High mobility group protein B1 (Hmgb1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Hmgb1. Target Synonyms: High mobility group protein 1. Accession Number: P63158. Expression Region: 2~215aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 25.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 25.7kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: GKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE
Target: Hmgb1