Recombinant Rat Heparanase (Hpse), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC27517
Article Name: Recombinant Rat Heparanase (Hpse), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27517
Supplier Catalog Number: RPC27517
Alternative Catalog Number: BIM-RPC27517-20UG,BIM-RPC27517-100UG,BIM-RPC27517-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Rat
Conjugation: Unconjugated
Alternative Names: Endo-glucoronidase (Hep)
Recombinant Rat Heparanase (Hpse), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus). Target Name: Hpse. Target Synonyms: Endo-glucoronidase (Hep). Accession Number: Q71RP1. Expression Region: 29~102aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 15.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 15.8kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: KDVVDLEFYTKRLFQSVSPSFLSITIDASLATDPRFLTFLGSPRLRALARGLSPAYLRFGGTKTDFLIFDPNKE
Target: Hpse