Recombinant Human 3 beta-hydroxysteroid dehydrogenase/Delta 5--4-isomerase type 1 (HSD3B1), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC27518
Article Name: Recombinant Human 3 beta-hydroxysteroid dehydrogenase/Delta 5--4-isomerase type 1 (HSD3B1), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27518
Supplier Catalog Number: RPC27518
Alternative Catalog Number: BIM-RPC27518-20UG,BIM-RPC27518-100UG,BIM-RPC27518-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type I
Recombinant Human 3 beta-hydroxysteroid dehydrogenase/Delta 5--4-isomerase type 1 (HSD3B1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: HSD3B1. Target Synonyms: 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type I. Accession Number: P14060. Expression Region: 2~237aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 33.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 33.4kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: TGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQNKTKLTVLEGDILDEPFLKRACQDVSVIIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNGHEEEPLENTWPAPYPHSKKLAEKAVLAANGWNLKNGGTLYTCALRPMYIYGEGSRFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILAL
Target: HSD3B1