Recombinant Goat Interferon gamma (IFNG), Unconjugated, E. coli

Catalog Number: BIM-RPC27520
Article Name: Recombinant Goat Interferon gamma (IFNG), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27520
Supplier Catalog Number: RPC27520
Alternative Catalog Number: BIM-RPC27520-20UG,BIM-RPC27520-100UG,BIM-RPC27520-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Goat
Conjugation: Unconjugated
Recombinant Goat Interferon gamma (IFNG) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Goat (Capra aegagrus hircus). Target Name: IFNG. Accession Number: P79154. Expression Region: 24~166aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 27.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 27.7kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: QGPFFKEIENLKEYFNASNPDVAKGGPLFSEILKNWKEESDKKIIQSQIVSFYFKLFENLKDNQVIQRSMDIIKQDMFQKFLNGSSEKLEDFKKLIQIPVDDLQIQRKAINELIKVMNDLSPKSNLRKRKRSQNLFRGRRASM
Target: IFNG