Recombinant Human Interleukin-1 alpha (IL1A), Biotinylated, Unconjugated, E. coli

Catalog Number: BIM-RPC27523
Article Name: Recombinant Human Interleukin-1 alpha (IL1A), Biotinylated, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27523
Supplier Catalog Number: RPC27523
Alternative Catalog Number: BIM-RPC27523-20UG,BIM-RPC27523-100UG,BIM-RPC27523-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Hematopoietin-1
Recombinant Human Interleukin-1 alpha (IL1A), Biotinylated is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: IL1A. Target Synonyms: Hematopoietin-1. Accession Number: P01583. Expression Region: 113~271aa. Tag Info: N-Terminal Mbp-Tagged And C-Terminal 6Xhis-Avi-Tagged. Theoretical MW: 65.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 65.8kDa
Tag: N-Terminal Mbp-Tagged And C-Terminal 6Xhis-Avi-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA
Target: IL1A