Recombinant Human Integrin beta-like protein 1 (ITGBL1), Unconjugated, E. coli

Catalog Number: BIM-RPC27524
Article Name: Recombinant Human Integrin beta-like protein 1 (ITGBL1), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27524
Supplier Catalog Number: RPC27524
Alternative Catalog Number: BIM-RPC27524-20UG,BIM-RPC27524-100UG,BIM-RPC27524-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Osteoblast-specific cysteine-rich protein, Ten integrin EGF-like repeat domain-containing protein
Recombinant Human Integrin beta-like protein 1 (ITGBL1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: ITGBL1. Target Synonyms: Osteoblast-specific cysteine-rich protein, Ten integrin EGF-like repeat domain-containing protein. Accession Number: O95965. Expression Region: 24~494aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 58.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 58.9kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: VPQSFSPSLRSWPGAACRLSRAESERRCRAPGQPPGAALCHGRGRCDCGVCICHVTEPGMFFGPLCECHEWVCETYDGSTCAGHGKCDCGKCKCDQGWYGDACQYPTNCDLTKKKSNQMCKNSQDIICSNAGTCHCGRCKCDNSDGSGLVYGKFCECDDRECIDDETEEICGGHGKCYCGNCYCKAGWHGDKCEFQCDITPWESKRRCTSPDGKICSNRGTCVCGECTCHDVDPTGDWGDIHGDTCECDERDCRA
Target: ITGBL1