Recombinant Human Ly6/PLAUR domain-containing protein 3 (LYPD3), Unconjugated, E. coli

Catalog Number: BIM-RPC27529
Article Name: Recombinant Human Ly6/PLAUR domain-containing protein 3 (LYPD3), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27529
Supplier Catalog Number: RPC27529
Alternative Catalog Number: BIM-RPC27529-20UG,BIM-RPC27529-100UG,BIM-RPC27529-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: GPI-anchored metastasis-associated protein C4.4A homolog (Matrigel-induced gene C4 protein, MIG-C4)
Recombinant Human Ly6/PLAUR domain-containing protein 3 (LYPD3) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: LYPD3. Target Synonyms: GPI-anchored metastasis-associated protein C4.4A homolog (Matrigel-induced gene C4 protein, MIG-C4). Accession Number: O95274. Expression Region: 31~326aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 37.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 37.1kDa
Tag: N-Terminal 10Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: LECYSCVQKADDGCSPNKMKTVKCAPGVDVCTEAVGAVETIHGQFSLAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLNLTSRALDPAGNESAYPPNGVECYSCVGLSREACQGTSPPVVSCYNASDHVYKGCFDGNVTLTAANVTVSLPVRGCVQDEFCTRDGVTGPGFTLSGSCCQGSRCNSDLRNKTYFSPRIPPLVRLPPPEPTTVASTTSVTTSTSAPVRPTSTTKPMPAPTSQTPRQGVE
Target: LYPD3