Recombinant Human 40S ribosomal protein S3 (RPS3), Unconjugated, E. coli

Catalog Number: BIM-RPC27552
Article Name: Recombinant Human 40S ribosomal protein S3 (RPS3), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27552
Supplier Catalog Number: RPC27552
Alternative Catalog Number: BIM-RPC27552-20UG,BIM-RPC27552-100UG,BIM-RPC27552-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Small ribosomal subunit protein uS3
Recombinant Human 40S ribosomal protein S3 (RPS3) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: RPS3. Target Synonyms: Small ribosomal subunit protein uS3. Accession Number: P23396. Expression Region: 2~243aa. Tag Info: C-Terminal 6Xhis-Tagged. Theoretical MW: 27.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 27.5kDa
Tag: C-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: AVQISKKRKFVADGIFKAELNEFLTRELAEDGYSGVEVRVTPTRTEIIILATRTQNVLGEKGRRIRELTAVVQKRFGFPEGSVELYAEKVATRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDEILPTTPISEQKGGKPEPPAMPQPVPTA
Target: RPS3