Recombinant Rat Secretogranin-3 (Scg3), Unconjugated, E. coli

Catalog Number: BIM-RPC27553
Article Name: Recombinant Rat Secretogranin-3 (Scg3), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27553
Supplier Catalog Number: RPC27553
Alternative Catalog Number: BIM-RPC27553-20UG,BIM-RPC27553-100UG,BIM-RPC27553-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Rat
Conjugation: Unconjugated
Alternative Names: 1B1075, Secretogranin III, SgIII
Recombinant Rat Secretogranin-3 (Scg3) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus). Target Name: Scg3. Target Synonyms: 1B1075, Secretogranin III, SgIII. Accession Number: P47868. Expression Region: 23~471aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 58.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 58.2kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: FPKPEGSQDKSLHNRELSAERPLNEQIAEAEADKIKKTYPSESKPSESNFSSVDNLNLLKAITEKETVEKAKQSIRSSPFDNRLNVDDADSTKNRKLTDEYDSTKSGLDRKVQDDPDGLHQLDGTPLTAEDIVHKIATRIYEENDRGVFDKIVSKLLNLGLITESQAHTLEDEVAEALQKLISKEANNYEEAPEKPTSRTENQDGKIPEKVTPVAATQDGFTNRENDDTVSNTLTLSNGLERRTNPHRDDDFEEL
Target: Scg3