Recombinant Pig Sialoadhesin (SIGLEC1), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC27556
Article Name: Recombinant Pig Sialoadhesin (SIGLEC1), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27556
Supplier Catalog Number: RPC27556
Alternative Catalog Number: BIM-RPC27556-20UG,BIM-RPC27556-100UG,BIM-RPC27556-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Porcine
Conjugation: Unconjugated
Alternative Names: pSn, Sialic acid-binding Ig-like lectin 1, Siglec-1, p210
Recombinant Pig Sialoadhesin (SIGLEC1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Pig (Sus scrofa, Porcine). Target Name: SIGLEC1. Target Synonyms: pSn, Sialic acid-binding Ig-like lectin 1, Siglec-1, p210. Accession Number: A7LCJ3. Expression Region: 20~153aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 22.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 22.3kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: SWTVSRPETVQGIKGSCLIIPCTFGFPANVEVPHGITAIWYYDYSGKRLVVSHSRNPKVVENHFQGRALLLGQAEQRTCSLLLKDLQPQDSGSYNFRFEISEGNRWSDVKGTVVTVTEVPSVPTIALPAKLHEG
Target: SIGLEC1