Recombinant Human Excitatory amino acid transporter 1 (SLC1A3), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC27557
Article Name: Recombinant Human Excitatory amino acid transporter 1 (SLC1A3), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27557
Supplier Catalog Number: RPC27557
Alternative Catalog Number: BIM-RPC27557-20UG,BIM-RPC27557-100UG,BIM-RPC27557-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Sodium-dependent glutamate/aspartate transporter 1, GLAST-1, Solute carrier family 1 member 3
Recombinant Human Excitatory amino acid transporter 1 (SLC1A3), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: SLC1A3. Target Synonyms: Sodium-dependent glutamate/aspartate transporter 1, GLAST-1, Solute carrier family 1 member 3. Accession Number: P43003. Expression Region: 146~236aa. Tag Info: N-Terminal 6Xhis-Ksi-Tagged. Theoretical MW: 25.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 25.5kDa
Tag: N-Terminal 6Xhis-Ksi-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: HPGKGTKENMHREGKIVRVTAADAFLDLIRNMFPPNLVEACFKQFKTNYEKRSFKVPIQANETLVGAVINNVSEAMETLTRITEELVPVPG
Target: SLC1A3