Recombinant Rauvolfia serpentina Strictosidine synthase (STR1), Unconjugated, E. coli

Catalog Number: BIM-RPC27571
Article Name: Recombinant Rauvolfia serpentina Strictosidine synthase (STR1), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27571
Supplier Catalog Number: RPC27571
Alternative Catalog Number: BIM-RPC27571-20UG,BIM-RPC27571-100UG,BIM-RPC27571-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Conjugation: Unconjugated
Recombinant Rauvolfia serpentina Strictosidine synthase (STR1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rauvolfia serpentina (Serpentine wood) (Ophioxylon serpentinum). Target Name: STR1. Accession Number: P68175. Expression Region: 23~344aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 43.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 43.2kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: SLALSSPILKEILIEAPSYAPNSFTFDSTNKGFYTSVQDGRVIKYEGPNSGFVDFAYASPYWNKAFCENSTDAEKRPLCGRTYDISYNLQNNQLYIVDCYYHLSVVGSEGGHATQLATSVDGVPFKWLYAVTVDQRTGIVYFTDVSTLYDDRGVQQIMDTSDKTGRLIKYDPSTKETTLLLKELHVPGGAEVSADSSFVLVAEFLSHQIVKYWLEGPKKGTAEVLVKIPNPGNIKRNADGHFWVSSSEELDGNMH
Target: STR1