Recombinant E. coli 3-demethoxyubiquinol 3-hydroxylase (ubiF), Unconjugated

Catalog Number: BIM-RPC27572
Article Name: Recombinant E. coli 3-demethoxyubiquinol 3-hydroxylase (ubiF), Unconjugated
Biozol Catalog Number: BIM-RPC27572
Supplier Catalog Number: RPC27572
Alternative Catalog Number: BIM-RPC27572-20UG,BIM-RPC27572-100UG,BIM-RPC27572-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: E. coli
Conjugation: Unconjugated
Alternative Names: 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase
Recombinant E. coli 3-demethoxyubiquinol 3-hydroxylase (ubiF) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli (strain K12). Target Name: ubiF. Target Synonyms: 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase. Accession Number: P75728. Expression Region: 1~391aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 46.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 46.5kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MTNQPTEIAIVGGGMVGGALALGLAQHGFAVTVIEHAEPAPFVADSQPDVRISAISAASVSLLKGLGVWDAVQAMRCHPYRRLETWEWETAHVVFDAAELKLPLLGYMVENTVLQQALWQALEAHPKVTLRVPGSLIALHRHDDLQELELKGGEVIRAKLVIGADGANSQVRQMAGIGVHAWQYAQSCMLISVQCENDPGDSTWQQFTPDGPRAFLPLFDNWASLVWYDSPARIRQLQNMNMAQLQAEIAKHFPS
Target: ubiF